PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma38g00890.1
Common NameZOSMA_38G00890
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family HB-other
Protein Properties Length: 155aa    MW: 18149.5 Da    PI: 8.988
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma38g00890.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox46.85.2e-154897655
                     S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55
                      +t eq+++L+++F++ ++ps +++ eL k lgL+++q+++WF N+ +  
  Zosma38g00890.1 48 IYTMEQIQILKSAFKEYSNPSVKQKDELCKILGLEKKQISNWFYNHQTHL 97
                     689******************************************97644 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.36E-1530101IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-153093IPR009057Homeodomain-like
PROSITE profilePS5007113.36240100IPR001356Homeobox domain
SMARTSM003894.7E-1041104IPR001356Homeobox domain
CDDcd000864.14E-1043101No hitNo description
PfamPF000461.4E-124897IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MSSTNGIGCG GDFEGNHQEG KQVENEWHTN GEEGDAPSLR KKKQKFHIYT MEQIQILKSA  60
FKEYSNPSVK QKDELCKILG LEKKQISNWF YNHQTHLKAK ERRLENSFLR NDNDRLKEEN  120
KRLWEAIKKS ICANCNNQLH EKIERLSLEE KRKC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13643PSLRKKKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9P7101e-110A0A0K9P710_Z
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.13e-28protodermal factor 2